Yüksek faturalara ve üşümeye son! Petek temizliği yaptırarak %40'a varan ısı tasarrufu sağlayabilirsiniz. Kağıthane'nin tüm mahallelerine servisimiz

1.67 Rating by CuteStat

kagithanepetektemizligi.com is 8 years 8 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, kagithanepetektemizligi.com is SAFE to browse.

PageSpeed Score
36
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 2
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 3
Google Adsense: Not Applicable Google Analytics: UA-68625080-19

Websites Hosted on Same IP (i.e. 77.92.140.32)

Kötü Sözlük'tü.

- kotusozluk.com
4,085,720 $ 240.00

Tam Haber | Güncel Haberler ve Son Dakika Haberleri

- tamhaber.com.tr

Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

7,102,027 $ 240.00

Index of /

- chicopeekedikopekmamalari.com
Not Applicable $ 8.95

Maya Cupcake | Harika Cupcake Çeşitleri

- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /

- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 11 Oct 2015 08:05:19 GMT
Server: Apache/2.4.16 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.45
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://kagithanepetektemizligi.com/xmlrpc.php
Link: <http://kagithanepetektemizligi.com/>; rel=shortlink
Content-Length: 27589
Connection: close
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: FBS Inc.
Registration Date: Sep 17, 2015, 12:00 AM 8 years 8 months 3 weeks ago
Last Modified: Sep 17, 2015, 12:00 AM 8 years 8 months 3 weeks ago
Expiration Date: Sep 17, 2016, 12:00 AM 7 years 8 months 3 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.kotuhost.com 212.68.61.245 Türkiye Türkiye
ns2.kotuhost.com 212.68.61.231 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
kagithanepetektemizligi.com A 14399 IP: 77.92.140.32
kagithanepetektemizligi.com NS 21599 Target: ns2.kotuhost.com
kagithanepetektemizligi.com NS 21599 Target: ns1.kotuhost.com
kagithanepetektemizligi.com SOA 21599 MNAME: ns1.kotuhost.com
RNAME: destek.labina.com.tr
Serial: 2015091703
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
kagithanepetektemizligi.com MX 14399 Target: kagithanepetektemizligi.com
kagithanepetektemizligi.com TXT 14399 TXT: v=spf1 +a +mx +ip4:77.92.140.32 ~all

Full WHOIS Lookup

Domain Name: KAGITHANEPETEKTEMIZLIGI.COM
Registry Domain ID: 1961130877_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.isimtescil.net
Registrar URL: http://www.isimtescil.net
Updated Date: 2015-09-17T14:24:01Z
Creation Date: 2015-09-17T14:24:03Z
Registrar Registration Expiration Date: 2016-09-17T14:24:03Z
Registrar: FBS Inc.
Registrar IANA ID: 1110
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Domain Admin Domain Admin
Registrant Organization: whoisprotection biz
Registrant Street: Bulgurlu Uskudar Note Visit whoisprotection biz t
Registrant City: Istanbul
Registrant State/Province:
Registrant Postal Code: 34000
Registrant Country: TR
Registrant Phone: +90.2163299393
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: contact@whoisprotection.biz
Registry Admin ID:
Admin Name: Domain Admin Domain Admin
Admin Organization: whoisprotection biz
Admin Street: Bulgurlu Uskudar Note Visit whoisprotection biz t
Admin City: Istanbul
Admin State/Province:
Admin Postal Code: 34000
Admin Country: TR
Admin Phone: +90.2163299393
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: contact@whoisprotection.biz
Registry Tech ID:
Tech Name: Domain Admin Domain Admin
Tech Organization: whoisprotection biz
Tech Street: Bulgurlu Uskudar Note Visit whoisprotection biz t
Tech City: Istanbul
Tech State/Province:
Tech Postal Code: 34000
Tech Country: TR
Tech Phone: +90.2163299393
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: contact@whoisprotection.biz
Name Server: ns1.kotuhost.com
Name Server: ns2.kotuhost.com
DNSSEC:Unsigned
Registrar Abuse Contact Email: abuse@domaintime.biz
Registrar Abuse Contact Phone: +90.8502000444
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>>Last update of WHOIS database: 2015-10-11T08:05:29+0000Z